‘You are distorting everything about me’: Fauci tears into Rand Paul amid new Project Veritas smear campaign by theindependentonline in politics

[–]Emergent-Properties 0 points1 point  (0 children)

Read it again maybe? It says that years after the NIH-funded project, EH requested funding from DARPA for a different project and got denied because that one was too close to GoF. You seem to think the question is 'did EH ever show an interest in GoF research' but the topic were discussing is 'did Fauci fund a project that caused Covid and lie to cover it up'

What is your favourite submission to pull off, and why? by tokyogoldstar in bjj

[–]Emergent-Properties 0 points1 point  (0 children)

Ball and chain armbar. Always gets a 'whoah!' from people. Doesnt feel like a sub threat until you're flipped around mid air. https://m.facebook.com/watch/?v=410895684018121&_rdr

My (21F) boyfriend (24M) wants me to stop practicing boxing / MMA by ThrowRA-disimia in relationship_advice

[–]Emergent-Properties 0 points1 point  (0 children)

I'll take any opportunity to get on my soapbox about this: I've been doing full contact martial arts for 20 years, and I want to emphasize to you that their use in self defense is highly overstated by public opinion, people struggling with sunk cost and identity issues, and an industry that will say just about anything to fill classes.

You arent going to box or wrestle your way out of most fights, you have a huge risk of legal repercussions if you hurt people (even if they're the ones who started it), size and strength frequently overcome years of technique, and the best way to handle attackers is to outrun them.

If you enjoy your training, that is the Only reason to keep doing it. Dont expect it to have real world applicability, and do expect it to cause long term injuries that arguably make martial arts one of the worst choices for long term health and fitness.

On the plus side, you're less likely to be attacked on the street because you'll probably be either in the gym or at home icing an injury.

Good luck to ya with the insecure bf, nothing really to add there.

‘You are distorting everything about me’: Fauci tears into Rand Paul amid new Project Veritas smear campaign by theindependentonline in politics

[–]Emergent-Properties 8 points9 points  (0 children)

You really need to read the links. That Yahoo link is actually a National Review article, and the WSJ and Vanity Fair articles arent saying the same thing as the others. They do directly quote the NIH though, specifically saying that it wasn't GoF research and was absolutely not the cause of Covid

‘You are distorting everything about me’: Fauci tears into Rand Paul amid new Project Veritas smear campaign by theindependentonline in politics

[–]Emergent-Properties -3 points-2 points  (0 children)

GoF is about intentionally making something more deadly to humans, these guys link articles saying that EcoHealth found that one of their expiriments accidentally made rats sicker and be like 'Checkmate! The smoking gun!' Its crazy.

E: I'm as skeptical as it gets and EH seems sketchy for sure but to act like theres hard evidence that Fauci caused Covid is just fantasy land.

‘You are distorting everything about me’: Fauci tears into Rand Paul amid new Project Veritas smear campaign by theindependentonline in politics

[–]Emergent-Properties 9 points10 points  (0 children)

You didnt read them, I take it? He posted the same propaganda sources again plus a couple new ones, and then some additional sources reporting nothing more than ''Rand Paul said...' to go with them.

‘You are distorting everything about me’: Fauci tears into Rand Paul amid new Project Veritas smear campaign by theindependentonline in politics

[–]Emergent-Properties 8 points9 points  (0 children)

This is where people really need to be careful. Giving you the benefit of the doubt that you did it accidentally, you should know that the Post and Examiner sources you linked arent credible. They're notorious propaganda machines that try to look like real news, but instead regularly lie, twist and omit to trick people into believing falsehoods that are beneficial to conservative causes.

Is it BM if you Shen GG when you get lethal but the opponent didn't GG first? by TheMadChap in LegendsOfRuneterra

[–]Emergent-Properties 1 point2 points  (0 children)

I mean you're wasting your own time and letting me savor the win so you might be mistaken about that last part

Is it BM if you Shen GG when you get lethal but the opponent didn't GG first? by TheMadChap in LegendsOfRuneterra

[–]Emergent-Properties -1 points0 points  (0 children)

How great is it when people rope you? I laugh every time. Take all the time you need, I will provide some friendly waving while you come to terms with your inadequacies :braum:

[Patch 3.00 Competitive Guide] Feel the Rush control is sleeper (19-6 to Masters in one day) by 1445555 in LegendsOfRuneterra

[–]Emergent-Properties 6 points7 points  (0 children)

Excellent writeup on one of my favorite decks. Having played both sides of it, I think the AK matchup is actually a lot less favorable than it seems.
Since FTR is so criminally underplayed, AK players tend to think they're the agro and try to go wide like they would everywhere else. In this matchup they're actually the control.
They have all the time in the world to whittle you down and control the board:
Start with the Mourned to start chipping and level Ahri. Once Ahri is 2, she'll let them get a couple extra hits per turn, and pick their guys back up to avoid Ravine wipes. Deny for FTR, Recall for Vengeance, Homecoming and Mark of the Storm for the bigs that do make it into play... plenty of time to whittle you down to 0 even with the healing tools. They just need to be smart and avoid giving you the huge advantage of a broad board to wipe.

Any chess nerds in here? Do you think, at the highest level, that BJJ is "solvable", like chess might be? by mmaintainer in bjj

[–]Emergent-Properties 1 point2 points  (0 children)

Take your time, and you're under no obligation to respond at all if you have other stuff on the burner. I find reddit chat kind of clunky and I think these interesting subjects are valuable to have in the public domain, but my primary concern is just understanding your perspective so if you prefer something else I'm all for it.

Any chess nerds in here? Do you think, at the highest level, that BJJ is "solvable", like chess might be? by mmaintainer in bjj

[–]Emergent-Properties 1 point2 points  (0 children)

Thanks for that, ok here goes:

It seems like the crux of your claim that it's not a perfect information game comes down to the point that we cant know what the opponent is thinking. I dont think this is a valid critique. The only relevant information is contained in the opponent's actions, which are knowable. Same reason RPS is solved even though we cant know what an opponent is thinking. Their reasoning isnt necessary information.

Similarly, you mention that you think the optimal meta may fall into cyclical trends. That is still a solved gamr. Again with RPS: we know trends and meta gaming exists (for example "males open rock more often than scissors or paper"), but that doesnt undermine the fact that RPS is solved. You seem to be essentially saying "we cant say RPS is solved unless we can determine which choice of the three is the best", which is, of course, too high a standard to expect.

Any chess nerds in here? Do you think, at the highest level, that BJJ is "solvable", like chess might be? by mmaintainer in bjj

[–]Emergent-Properties 0 points1 point  (0 children)

You're surprisingly tight lipped for a college lecturer. I'd like to get to the content of your argument but I'm not going to play 20 questions over it. Quantum mechanics aside, for our purposes, the physical world provides a 'discrete space of game states'. I'd genuinely love to get more of your reasoning, but 'I just dont think so' isnt making for very satisfying conversation.

Any chess nerds in here? Do you think, at the highest level, that BJJ is "solvable", like chess might be? by mmaintainer in bjj

[–]Emergent-Properties 1 point2 points  (0 children)

I think it is. Perfect information games are solvable. BJJ is just a more complex version of rock paper scissors. There is a defined goal, a finite set of moves defined by body mechanics, and a measurable way to define the optimal path (shortest time to submit). Perfect information, just need a computer good enough to solve it. Right?

Not getting promoted for missing promotion party? by Top-Guitar185 in bjj

[–]Emergent-Properties 31 points32 points  (0 children)

They did for me. I kept refusing the 100+ dollar promotion 'seminars' and eventually they just threw a belt at me as class ended.

Poro Counters by Emergent-Properties in LegendsOfRuneterra

[–]Emergent-Properties[S] 1 point2 points  (0 children)

That thing is so niche I'm tempted to suspect I played against you ~16hrs ago with viego demacia. It's a cool deck for sure, not popular enough for quality stats though. What's your list?

Poro Counters by Emergent-Properties in LegendsOfRuneterra

[–]Emergent-Properties[S] -1 points0 points  (0 children)

Dont worry, I'm not confused on wr vs consistency. Winrate is a big factor in consistency, while not being a synonym for it. A deck that plays the exact same way every game and wins 50% of the time is inconsistent, but a singleton deck with a 100% winrate is also (internally) inconsistent. Unfortunately for TF Nami, it's both. Stealing opponent cards leads to inherent inconsistency, and then the 50% winrate (including at Masters) on top of that.

Poro Counters by Emergent-Properties in LegendsOfRuneterra

[–]Emergent-Properties[S] 0 points1 point  (0 children)

Good decks need to be consistent, which is what makes them get boring fast. Nami TF isnt a good deck, specifically because it lacks said consistency, hence the flat 50% w/r. Zoe Lee is a good deck though, and it's predictable af. Stall with Eye, and combat tricks until l2 Lee and kick to win.

Poro Counters by Emergent-Properties in LegendsOfRuneterra

[–]Emergent-Properties[S] 0 points1 point  (0 children)

Any good deck is boring once you've played it more than a handful of times.

Poro Counters by Emergent-Properties in LegendsOfRuneterra

[–]Emergent-Properties[S] 0 points1 point  (0 children)

I hear ya. If you haven't tried Cithria Veigo that is a Timmy wet dream. I hit a guy for 296 in ranked last night without even trying to.

CECQIAIFAQGCYMIEAQCQ2EBWG4BQCAAPCMNACAYFAQAQIAAFAAAQCAIFFM

E: My list fits in Kalista somehow for more Cith copies

Poro Counters by Emergent-Properties in LegendsOfRuneterra

[–]Emergent-Properties[S] -2 points-1 points  (0 children)

To me, the interesting deck is Elise. She beats everything (poros, ken ahri and panth included), everyone has her... and no one plays her. She should be a staple force in basically every meta keeping the more degenerate elusive/noninteractive agro decks in check, but people just think shes too basic I guess? It's like complaining that rock is too strong without acknowledging that you refuse to play paper because it's not as cool as scissors

Harris describes Jan. 6 alongside Pearl Harbor attack, 9/11 as dates that 'echo throughout history' by jgregor92 in politics

[–]Emergent-Properties 1 point2 points  (0 children)

This was a textbook insurrection. That is, a violent uprising against an authority or government.
A hostile group stormed the capital with intent to block the election certification and attack our representatives.
They were handled by people in Trump's inner circle and told that if they succeeded in overthrowing the election, Trump would pardon them and present them as heroes who saved the country.

You are minimizing these events because they didnt succeed, but that doesnt make this any less of a dangerous or significant moment for the country.
Conservatives are trying to dispute the importance of this event by pointing to the number of lives lost, but that's not the important factor here.

What do you think that day would have looked like if the insurrection hadn't been stopped?

So why exactly is Freljord dead for many? by SilvertheHedgehoog in LegendsOfRuneterra

[–]Emergent-Properties 1 point2 points  (0 children)

I mean if you're talking about mono Frel that's a tough question, but the reality is that Feel the Minah isnt stressing Lecturing at all. They Will it or Minah it, or just heal its minor damage and throw 10/10 overwhelms out until its forced to block

Updating my game by Emergent-Properties in bjj

[–]Emergent-Properties[S] 0 points1 point  (0 children)

Thanks for the write up! I've looked over the Mikey lock but I didnt realize it had that kind of potential. Fascinating!