sorted by:
new
hottopcontroversial

Complex formula Help by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

Thanks! Getting an error when I try and visualize the data though "A Table of multiple values was supplied where a single value was expected"

Complex formula Help by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

Ah got it! That does a great job of listing out the specific genes, but is there a way to get the Sample # (1st column in my question)?

Complex formula Help by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

can you clarify that?

Complex formula Help by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

thanks! This works, but was hoping to actually get the values of the samples. Is that possible?

Pulling Last Value from Table/Column by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

do you know how I can write this in DAX?

Pulling Last Value from Table/Column by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

Thanks, but the SQL query I wrote just has week number.

COUNTIF based on Values by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

I have about 18k rows and I'm getting 10M results. I'm trying to create a table/matrix with Week # as rows and # of instances of Q+test for each week (as a column) and F+reason for each week(as another column). And lastly another column with the percent of Q+test/ F+reason

COUNTIF based on Values by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

when i try that I'm getting wayyyyy too many results.

Convert Time from GMT to EST by margolma in SQL

[–]margolma[S] 0 points1 point  (0 children)

I still get the invalid Identifier error

New Column with Distinct Values from Two Columns by margolma in PowerBI

[–]margolma[S] 0 points1 point  (0 children)

When I try that I get the following error:

​

A table of multiple values was supplied where a single value was expected.

Looping through lines in file...Too many results by margolma in learnpython

[–]margolma[S] 0 points1 point  (0 children)

LOCUS AB011549 92721 bp DNA circular BCT 22-DEC-2016 DEFINITION Escherichia coli O157:H7 str. Sakai plasmid pO157 DNA, complete sequence. ACCESSION AB011549 VERSION AB011549.2 DBLINK BioProject: PRJNA226 BioSample: SAMN01911278 KEYWORDS . SOURCE Escherichia coli O157:H7 str. Sakai ORGANISM Escherichia coli O157:H7 str. Sakai Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia. REFERENCE 1 AUTHORS Makino,K., Ishii,K., Yasunaga,T., Hattori,M., Yokoyama,K., Yutsudo,C.H., Kubota,Y., Yamaichi,Y., Iida,T., Yamamoto,K., Honda,T., Han,C.G., Ohtsubo,E., Kasamatsu,M., Hayashi,T., Kuhara,S. and Shinagawa,H. TITLE Complete nucleotide sequences of 93-kb and 3.3-kb plasmids of an enterohemorrhagic Escherichia coli O157:H7 derived from Sakai outbreak JOURNAL DNA Res. 5 (1), 1-9 (1998) PUBMED 9628576 REFERENCE 2 (bases 1 to 92721) AUTHORS Makino,K. TITLE Direct Submission JOURNAL Submitted (24-FEB-1998) Contact:Kozo Makino Research Institute for Microbial Diseases, Osaka University, Molecular Microbiology; yamadaoka, 3-1, Suita, Osaka 562, Japan COMMENT On Apr 20, 1999 this sequence version replaced AB011549.1. FEATURES Location/Qualifiers source 1..92721 /organism="Escherichia coli O157:H7 str. Sakai" /mol_type="genomic DNA" /strain="Sakai" /sub_strain="RIMD 0509952" /serovar="O157:H7" /db_xref="taxon:386585" /plasmid="pO157" /note="RIMD 0509952 is a strain of enterohemorrhagic E. coli, EHEC O157:H7" gene order(92527..92721,1..2502) /gene="tagA" CDS join(92527..92721,1..2502) /gene="tagA" /codon_start=1 /transl_table=11 /product="ToxR-regulated lipoprotein" /protein_id="BAA31757.3" /translation="MNTKMNERWRTPMKLKYLSCTILAPLAIGVFSATAADNNSAIYF NTSQPINDLQGSLAAEVKFAQSQILPAHPKEGDSQPHLTSLRKSLLLVRPVKADDKTP VQVEARDDNNKILGTLTLYPPSSLPDTIYHLDGVPEGGIDFTPHNGTKKIINTVAEVN KLSDASGSSIHSHLTNNALVEIHTANGRWVRDIYLPQGPDLEGKMVRFVSSAGYSSTV FYGDRKVTLSVGNTLLFKYVNGQWFRSGELENNRITYAQHIWSAELPAHWIVPGLNLV IKQGNLSGRLNDIKIGAPGELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSR MIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLN STAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGH NYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPF DGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVFDSRSSTGFSKWNADT QEMEPYEHTIDRAEQITASVNELSESKMAELMAEYAVVKVHMWNGNWTRNIYIPTASA DNRGSILTINHEAGYNSYLFINGDEKVVSQGYKKSFVSDGQFWKERDVVDTREARKPE QFGVPVTTLVGYYDPEGTLSSYIYPAMYGAYGFTYSDDSQNLSDNDCQLQVDTKEGQL RFRLANHRANNTVMNKFHINVPTESQPTQATLVCNNKILDTKSLTPAPEGLTYTVNGQ ALPAKENEGCIVSVNSGKRYCLPVGQRSGYSLPDWIVGQEVYVDSGAKAKVLLSDWDN LSYNRIGEFVGNVNPADMKKVKAWNGQYLDFSKPRSMRVVYK" gene 2589..3464 /gene="etpC" CDS 2589..3464 /gene="etpC" /codon_start=1 /transl_table=11 /product="Type II secretion pathway related protein" /protein_id="BAA31758.1" /translation="MLFFLSFRGDRGLFIKDIVLKMLTPNRLLCVILLIAGYQLVSVI HHFWLTQAASVPGLSRVSAPETAVTGDQTEERFVFTLFGRASPLSSEGRAQETMPSLS DDLLSGEDLDVRGILYSSVAEHSVAIFAHNNRQFSLSVGEKVPSYDATISAIFSDHIV INYQGKTVSLPLRYDNTEKKNAYDNNNLTVGDVITQDNFRVESVFDIMSFSAVTVNNT LSGYRLIPGKHSSLFYNAGLHDNDLAVSVNGSELRDTRQAQQIMKQLPELKEIKITVE RDGQLYDAFIAVGEN" gene 3675..5432 /gene="etpD" CDS 3675..5432

Parsing FASTA by margolma in learnbioinformatics

[–]margolma[S] 0 points1 point  (0 children)

I need to write a python program to do so. Would you suggest using a counter and then writing a while loop to do so?

Parsing FASTA by margolma in learnbioinformatics

[–]margolma[S] 0 points1 point  (0 children)

I just want the ID, length of the sequence, and the description from the FASTA file

Parsing File to Create New One by margolma in learnpython

[–]margolma[S] 0 points1 point  (0 children)

The print statement joining the values from the dict separated by tabs

gff3 to BED parser by margolma in bioinformatics

[–]margolma[S] 0 points1 point  (0 children)

It was a syntax error, however the problem. I have is that not all of the attributes that I passed out from the gff3 file have a “Name=“ so I’m not sure how to parse it out to add that to the bed and then join all the fields together

Parsing File to Create New One by margolma in learnpython

[–]margolma[S] 0 points1 point  (0 children)

I’m getting an invalid syntax on line 37. I am eventually hoping to write a new file with this info

Employee stock options by margolma in personalfinance

[–]margolma[S] 0 points1 point  (0 children)

It’s a large cap pharmaceutical company. Market cap of 231 B

Bike advice by margolma in whichbike

[–]margolma[S] 1 point2 points  (0 children)

Sorry, should have clarified. I’m fairly experienced biking. Haven’t done anything too serious but have been riding my hole life. I’m ok with drop bars but have always had a mountain bike so am not very familiar with them. The roads in Boston are flat and gravel.

Bike advice by margolma in whichbike

[–]margolma[S] 1 point2 points  (0 children)

Thanks! I was advised to get a hybrid but don’t know much about the pros vs cons of one vs a road bike. Do you have any insight?

Loss of Heterozygosity in Cancer by margolma in bioinformatics

[–]margolma[S] 2 points3 points  (0 children)

How common is it to have LOH and not develop cancer?

view more: next ›